kaltim.tribunnews.com website review
Improve your SEO :: free trial!
Most important optimization pointers for kaltim.tribunnews.com
This is a prioritized list for kaltim.tribunnews.com of the issues, ordered ascending, and starting with the biggest quick wins for your website. The biggest quick win is the opportunity that requires the least effort to implement compared to the optimization payoff in effect.
There are too many links on this page, consider removing some links
Improve the relevance of the headings
Improve the link descriptions
kaltim.tribunnews.com is 54% geoptimaliseerd!
SEO Keyword summary for kaltim.tribunnews.com
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be lalu
Focus keyword
Short and long tail
Short Tail Keywords lalu jam dan |
long Tail Keywords (2 words) jam lalu lalu berita tribun etam jakarta selatan 1 jam |
long Tail Keywords (3 words) jam lalu berita 4 jam lalu 1 jam lalu milyar dki jakarta dki jakarta jakarta 2 jam lalu jakarta jakarta selatan |
kaltim.tribunnews.com On-Page SEO Scan
Descriptive Elements
The <head> element of a kaltim.tribunnews.com page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
tribunkaltimco berita dan video terkini seputar peristiwa sepak bola selebriti kesehatan travel hiburan wiki dari kalimantan timur sekitarnya
Meta description
Meta description legth
Meta description SEO
tribunkaltimco menyajikan berita dan video terkini seputar peristiwa sepak bola selebriti kesehatan travel hiburan wiki dari kalimantan timur sekitarnya
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
tribunkaltimco tribun tangkapanlayarcctvmenunjukkandetikdetikjpg wakilketuakomisiiiidprdbalikpapanpadlianorjpg hasyakylajpg ganjarpranowodangibranrakabumingrakajpg ganjarpranowo jpg gurutamanpendidikanalqurandikabupatenpaserraniningsihjpg bagianatapmasjidjamiajiamirhasanuddinditenggarongjpg jadwalsidangisbatlebaranidulfitri syawal hjpg msihrandanahmadnurhardiantomenggelarlatihanbersamajpg kepalabkadkubarpetrusjpg hotmanprabowojpg kaptenborneofcdiegomichielssaatsesilatihandistadionbatakanbalikpapanjpg contohtulisanhamperslebaranyangunikjpg nuzululquranjpg penandatanganandokumenmasterplaniadlanskapsegahjpg jokowiprabowojenderalkehormatanbintang mahkamahkonstitusisidangsengketapilpres amicuscuriaejpg pantunidulfitri yangunikdanmenarikuntukmenyambutharilebaran pjgubernurkaltimakmalmalikmenandatanganisuratrotasijabatanjpg shopping logo rekomendasi murah harga jutaan yang bisa dibeli pakai uang thr keunggulan dan kelemahan infinix note pro dibanderol apakah worth jangan asal diletakkan posisi ketinggian ideal meletakkan televisi benar kamar tidur vacuum tumbler siap temani mudik jaga suhu air lebih lama dikitdikit minum obat awas ini bahaya mengintaimu abaikan rasa pahitnya manfaat daun pepaya untuk menjaga kesehatan tubuh orangtuaharveymoeisjpg anieshotmanjpg sarocoffeeandeateryyangberlokasidikawasanperumahansepingganpratamajpg polresberausaatmemusnahkanbarangbuktisabujpg cpns danpppkjpg lapanganminisoccerdistadionajiimbutjpg tribunkaltimconurilafirdausjpg hakangketprabowomegawatipdipjokowijpg bupatipaserfahmifadlisaatmembukamusrenbangrkpdkabupatenpasertahun bpnt kolasetangkapanlayarfeelsinstagramjpg linkppkucingramadhanjpg kemdikbudristekcpns dkjjpg ratusanpolisiraziaketupatjpg gempagunungkiduljpg tadarusyangrutindilakukanmudamudidimasjidbaabulhafazahjpg ilustrasipekerjadiiknjpg tanggapanuahsoalfilmkiblatjpg sandradewiharveymoeisjetpribadijpg walikotasamarindaandiharun puluhanpolisimelaksanakanapelpagidihalamanmapolresbontangjpg sandradewidanharveymoeis bupatikutaitimurardiansyahsulaimanjpg pencoblosansurveicapres terbaruhariinielektabilitaspilpres pilpres tenagahonorerdilingkunganpemkotsamarindajpg polrestabalikpapangelarrapatlintassektoraljpg whatsappcaramengatasiwhatsapptakbisabusadibukajpg tribunjualbeli ruko lantai jalan haji nawi raya cilandak jakarta selatan rumah minimalis ekonomis sleman graha mas fatmawati kebayoran baru lelang samali ujung pasar minggu tebet barat dalam dijual dekat stadion maguwo ngemplak perusahaan ekspedisi door aiden davinci toni logistik idaman investasi cerdas borobudur magelang bungur besar kemayoran pusat pasir pasang cor limestone bekasi induk cipinang perumahan rancaekek sindanglaya arcamanik sawangan depok supomo office park menteng penganten ali ciracas timur termurah lahan keselamatan tipe purwomartani kalasan wujudkan impian cantik cuman comscore
Mobile SEO kaltim.tribunnews.com
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
Flash detected
Mobile improvement
Marketing / lead generation for kaltim.tribunnews.com
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
The title is trucated
SERP Link
SERP Description
Domain Level SEO
Domain name
21 characters long
Domain name SEO Impact
news found in domain name !
tribun found in domain name !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
tribunkaltimco
|
kalimantan-utara malinau
nunukan
tana tidung
tanjung selor
tarakan
|
kaltim.tribunnews.com mata lokal memilih
tribun etam
bisnis
super ball
lifestyle
epaper
techno
travel
otomotif
kesehatan
indeks
kaltim berdaulat
parlementaria kaltim
kubar beradat
kukar kota raja
kaltara benuanta
indeks az
valsubtitle
valtitlevtitle
valstitle
ramadan
iklan online
berita populer
topik populer
terms of use
contact us
redaksi
info iklan
|
lifestyle kecantikan
bugar
parenting
kesehatan
|
mata-lokal-memilih pemilu legislatif
pilpres
pilkada
sejarah pemilu
|
seleb gosipi
musik
cinema tv
|
superball liga indonesia
liga champions
liga inggris
liga italia
liga spanyol
liga jerman
liga lainnya
soccer style
lainnya
|
tag tag populer
iad lanskap segah
amicus curiae
kapan malam nuzulul quran 2024
saro coffee and eatery
bpnt april 2024
bpnt april 2024 kapan cair
harvey moeis anak siapa
siapa harvey moeis
pengamanan idul fitri
keutamaan shalat tarawih malam ke 18
fadhilah tarawih malam ke 18
masjid sultan
aji amir hasanuddin
darah haid
ragu darah haid atau bukan
harga tiket pesawat balikpapan yogyakarta
thr pensiunan 2024
thr pensiunan 2024 kapan cair
harvey moeis ditahan
newton
|
topic berita balikpapan terkini
kabar artis
berita nasional terkini
berita paser terkini
idul fitri 2024
liga 1
berita kubar terkini
pilpres 2024
ramadhan 2024
berita berau terkini
berita nasional terkini
berita kaltim terkini
kabar artis
cpns 2024
berita kukar terkini
berita kutim terkini
bantuan sosial
ibu kota negara
berita balikpapan terkini
gempa hari ini
sinopsis film
berita samarinda terkini
berita bontang terkini
aplikasi
|
topics jejak islam di bumi etam
pilpres 2024
ramadhan 2024
berita nasional terkini
tribun kaltim hari ini
berita balikpapan terkini
promo
berita samarinda terkini
idul fitri 2024
cpns 2024
ibu kota negara
|
travel akomodasi
kuliner
destinasi
shopping
ticketing
|
tribun-etam balikpapan
berau
bontang
penajam
samarinda
sangatta
sendawar
tenggarong
paser
mahulu
|
2024 5 fakta kecelakaan maut di tanjakan mazda
/03/27/soal-uang-sewa-rumah-korban-kebakaran-di-klandasandprd-balikpapan-minta-dilakukan-penyesuaian
soal uang sewa rumah korban kebakaran di
/03/27/profilbiodata-hasyakyla-eks-jkt48-yang-disorot-karena-ngaku-nyetir-sambil-mabuk-hingga-nabrak
profilbiodata hasyakyla eks jkt48 yang
kelakar gibran respons ganjar tolak jadi
ganjar beber hanya perlu 5 orang untuk buktikan ifibc 1 googletagcmdpushfunction googletagdisplaydivheadlinethumb5 ibc ibc 1
kisah rani ningsih guru tpa di paser yang sukses berbisnis ikan asin kering
jejak islam di bumi etam 17 orang kepercayaan sultan dipilih jadi arsitek masjid
kapan idul fitri 2024 prediksi 1 syawal 1445 h jatuh pada 10 april 2024 jadwal sidang isbat
kantongi tiket championship series pelatih borneo fc pieter huistra beberkan targetnya
siapsiap thr tkk di kubar bakal cair dalam waktu dekat
/03/28/hotman-paris-marah-suara-prabowo-gibran-dianggap-nol-beri-kritik-keras-ke-kubu-ganjar-pranowo
hotman paris marah suara prabowogibran dianggap nol beri kritik keras ke kubu ganjar pranowo
borneo fc bermain tanpa silverio pieter huistra optimis timnya curi 3 poin atas psm makassar
20 contoh tulisan hampers lebaran yang unik dan penuh makna cocok untuk segala usia
5 amalan nuzulul quran yang bisa dikerjakan malam ini menurut penjelasan ustaz adi hidayat
bupati berau setujui masterplan iad lanskap segah
alasan jokowi ogah komentari proses sidang gugatan mk anies dan ganjar vs prabowo
guru besar dan masyarakat sipil kirim amicus curiae minta hakim mk tak hanya urus perolehan suara
60 pantun idul fitri 2024 yang unik dan menarik untuk menyambut hari lebaran 1445 h
beredar isu pejabat kaltim enggan berikan data aset komisi ii dprd kita harus fair
/03/28/terungkap-sudah-harvey-moeis-anak-siapa-sosok-orang-tua-dan-sumber-kekayaan-suami-sandra-dewi
terungkap sudah harvey moeis anak siapa sosok orang tua dan sumber kekayaan suami sandra dewi
anggap permohonan anies baswedan asumsi hingga narasi hotman paris bisa dijawab dengan 1 kalimat
saro coffee and eatery sepinggan pratama hadirkan paket menu spesial ramadan harga mulai rp 50 ribu
komitmen berantas narkoba polres berau musnahkan 2399 gram sabu
info terbaru kapan pengumuman formasi cpns 2024 pdf cek cara daftar cpns 2024 lulusan smasmk
promo ramadan 2024 sewa lapangan mini soccer stadion aji imbut di kukar gratis 1 jam
peringatan nuzulul quran digelar di masjid agung al faruq sangatta hadirkan ustaz muhammaf yasir
akhirnya terjawab jawaban puan maharani respons isu pertemuan megawati dan prabowo subianto
ptt di paser dipastikan dapat gaji 13 dan thr hari raya idul fitri 1445 hijriah
terbaru bpnt april 2024 kapan cair cek prediksi jadwaltanggal pencairan dan info pkh tahap 2
polda kaltim ungkap peredaran 32 kg sabu berawal dari pengembangan kasus di samarinda
90 link pp kucing ramadhan 2024 pakai peci dan berhijab yang menggemaskan ganti pp sebelum lebaran
info cpns 2024 cara daftar cpns 2024 lulusan smasmk prediksi formasi cpns2024untuk d3s1
sah jakarta tak lagi dki dan punya nama baru pks tolak ruu dkj dan sorot kekurangan ikn nusantara
525 personel gabungan disiapkan untuk amankan arus mudik lebaran 2024 di balikpapan
update gempa 2 menit lalu 50 magnitudo di gunung kidul yogyakarta cek pusat gempa bmkg terkini
kejar pahala bulan ramadan puluhan mudamudi di gunung lingai samarinda rutin gelar tadarus
mudik lebaran 2024 pekerja ikn nusantara pemerintah siapkan pesawat hercules dan kapal laut
viral kontroversi film kiblat yang dilarang tayang begini tanggapan ustaz adi hidayat
latar belakang keluarga harvey moeis dan sumber kekayaan suami sandra dewi kaya sejak lahir
2 pertimbangan walikota samarinda memutuskan thr tenaga honorer rp 2 juta yang sebelumnya rp 1 juta
polres bontang akan siapkan 378 personel gabungan di operasi ketupat 2024
terbaru terjawab harvey moeis anak siapa ini profilbiodata suami sandra dewi dan kasus korupsinya
ringankan beban masyarakat pemkab kutim serahkan santunan pada 50 anak yatim
prabowogibran diprotes kpu heran aniescak imin dan ganjarmahfud tetap ikut tahapan pemilu
6000 lebih tenaga honorer di pemkot samarinda akan terima thr rp2 juta
polresta balikpapan siapkan strategi pengamanan idul fitri ini poinpoinnya
info whatsapp 2024 fitur ai perubahan tampilan hingga tak bisa screenshot foto profil user lain
|
Links to external pages
Outloing links
aceh.tribunnews.com
prohaba.tribunnews.com
gayo.tribunnews.com
medan.tribunnews.com
padang.tribunnews.com
pekanbaru.tribunnews.com
batam.tribunnews.com
jambi.tribunnews.com
sumsel.tribunnews.com
palembang.tribunnews.com
bangka.tribunnews.com
belitung.tribunnews.com
babel.tribunnews.com
bengkulu.tribunnews.com
lampung.tribunnews.com
jakarta.tribunnews.com
wartakota.tribunnews.com
banten.tribunnews.com
tangerang.tribunnews.com
depok.tribunnews.com
bekasi.tribunnews.com
bogor.tribunnews.com
priangan.tribunnews.com
cirebon.tribunnews.com
jateng.tribunnews.com
solo.tribunnews.com
banyumas.tribunnews.com
muria.tribunnews.com
pantura.tribunnews.com
mataraman.tribunnews.com
jatim.tribunnews.com
surabaya.tribunnews.com
suryamalang.tribunnews.com
madura.tribunnews.com
jatim-timur.tribunnews.com
jogja.tribunnews.com
bali.tribunnews.com
pontianak.tribunnews.com
kalteng.tribunnews.com
kaltara.tribunnews.com
banjarmasin.tribunnews.com
sulbar.tribunnews.com
makassar.tribunnews.com
toraja.tribunnews.com
sultra.tribunnews.com
palu.tribunnews.com
manado.tribunnews.com
gorontalo.tribunnews.com
lombok.tribunnews.com
mataram.tribunnews.com
flores.tribunnews.com
kupang.tribunnews.com
ternate.tribunnews.com
ambon.tribunnews.com
papua.tribunnews.com
papuabarat.tribunnews.com
sorong.tribunnews.com
www.tribunnews.com
www.tribunnewswiki.com
style.tribunnews.com
travel.tribunnews.com
wow.tribunnews.com
newsmaker.tribunnews.com
trends.tribunnews.com
health.tribunnews.com
shopping.tribunnews.com
video.tribunnews.com
www.tribunjualbeli.com
booking.tribunnews.com
career.tribunnetwork.com
www.tribunnews.com
www.gramedia.com
ebooks.gramedia.com
www.youtube.com
www.facebook.com
www.instagram.com
www.twitter.com
news.google.com
www.tiktok.com
account.tribunnews.com
account.tribunnews.com
tribunkaltimtravel.tribunnews.com
www.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
www.tribunjualbeli.com
www.tribunnews.com
www.tribunnews.com
www.tribunnews.com
www.tribunnews.com
SEO Advice for kaltim.tribunnews.com
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 29% | A title should reflect the contents of a site. This site has a 22 % match | |
Title Length | 50% | Limit your title to anywhere between 40 and 70 characters. Your title was 158 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 95% | The meta description should be between 145 and 160 characters. This meta description is 167 characters long. | |
Meta description relevance | 38% | Meta Description should reflect the contents of a site. This site has a 21 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 320 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 11 level 1 folders and 17 folders above or in the first level of navigation. | |
Headings | 18% | Headers should reflect the contents of a site. This site has a 8 % match | |
Links | 10% | Link anchors should to some degree reflect the contents of a site. This site has a 5 % match | |
Image alt tags | 20% | Image alt tags should to some degree reflect the contents of a site. This site has a 7 % match | |
Bold and italic | 100% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 50 % match | |
Html ratio | 75% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 100% | All images on this page have been described. Great job ! | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 2539 words | |
Server response time | 100% | A fast server speeds up a website. This server responds 65.2% faster then average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 92 inline style declarations ( <a style="color:green">) with a size of 2486 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 1 frame(s) on your page | |
Flash | 20% | Crawlers do not crawl faslh object. Wij found 1 flash object(s) | |
Css | 30% | We detected too much (4) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (18) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
kaltim.tribunnews.com images and descriptions
83 images found at kaltim.tribunnews.com Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://asset-1.tstatic.net/img/logo/daerah/svg3/tribunkaltim.svg height: 40 width: width attribute not set description: tribunkaltim.co |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/logo_t_blue.svg height: 21 width: 21 description: tribun |
|
https://asset-2.tstatic.net/kaltim/foto/bank/images2/20240327-tangkapan-layar-cctv-menunjukkan-detik-detik.jpg height: 365 width: 650 description: 20240327-tangkapan-layar-cctv-menunjukkan-detik-detik.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/images2/20240327_wakil-ketua-komisi-iii-dprd-balikpapan-padlianor.jpg height: 365 width: 650 description: 20240327_wakil-ketua-komisi-iii-dprd-balikpapan-padlianor.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/images2/20240327_hasyakyla.jpg height: 365 width: 650 description: 20240327_hasyakyla.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/images2/ganjar-pranowo-dan-gibran-rakabuming-raka.jpg height: 365 width: 650 description: ganjar-pranowo-dan-gibran-rakabuming-raka.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/images2/20240305_ganjar-pranowo-1.jpg height: 365 width: 650 description: 20240305_ganjar-pranowo-1.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240327-tangkapan-layar-cctv-menunjukkan-detik-detik.jpg height: 96 width: 129 description: 20240327-tangkapan-layar-cctv-menunjukkan-detik-detik.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240327_wakil-ketua-komisi-iii-dprd-balikpapan-padlianor.jpg height: 96 width: 129 description: 20240327_wakil-ketua-komisi-iii-dprd-balikpapan-padlianor.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240327_hasyakyla.jpg height: 96 width: 129 description: 20240327_hasyakyla.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/ganjar-pranowo-dan-gibran-rakabuming-raka.jpg height: 96 width: 129 description: ganjar-pranowo-dan-gibran-rakabuming-raka.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240305_ganjar-pranowo-1.jpg height: 96 width: 129 description: 20240305_ganjar-pranowo-1.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_guru-taman-pendidikan-al-quran-di-kabupaten-paser-rani-ningsih.jpg height: 90 width: 120 description: 20240328_guru-taman-pendidikan-al-quran-di-kabupaten-paser-rani-ningsih.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240327_bagian-atap-masjid-jami-aji-amir-hasanuddin-di-tenggarong.jpg height: 90 width: 120 description: 20240327_bagian-atap-masjid-jami-aji-amir-hasanuddin-di-tenggarong.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_jadwal-sidang-isbat_lebaran-idul-fitri-2024-1-syawal1445-h.jpg height: 90 width: 120 description: 20240328_jadwal-sidang-isbat_lebaran-idul-fitri-2024-1-syawal1445-h.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_m-sihran-dan-ahmad-nur-hardianto-menggelar-latihan-bersama.jpg height: 90 width: 120 description: 20240328_m-sihran-dan-ahmad-nur-hardianto-menggelar-latihan-bersama.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_kepala-bkad-kubar-petrus.jpg height: 90 width: 120 description: 20240328_kepala-bkad-kubar-petrus.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20231021_hotman-prabowo.jpg height: 90 width: 120 description: 20231021_hotman-prabowo.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_kapten-borneo-fc-diego-michiels-saat-sesi-latihan-di-stadion-batakan-balikpapan.jpg height: 90 width: 120 description: 20240328_kapten-borneo-fc-diego-michiels-saat-sesi-latihan-di-stadion-batakan-balikpapan.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20-contoh-tulisan-hampers-lebaran-yang-unik.jpg height: 90 width: 120 description: 20-contoh-tulisan-hampers-lebaran-yang-unik.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/nuzulul-quran.jpg height: 90 width: 120 description: nuzulul-quran.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_penandatanganan-dokumen-masterplan-iad-lanskap-segah.jpg height: 90 width: 120 description: 20240328_penandatanganan-dokumen-masterplan-iad-lanskap-segah.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240228_jokowi_prabowo_jenderal-kehormatan_bintang-4.jpg height: 90 width: 120 description: 20240228_jokowi_prabowo_jenderal-kehormatan_bintang-4.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_mahkamah-konstitusi_sidang_sengketa-pilpres-2024_amicus-curiae.jpg height: 90 width: 120 description: 20240328_mahkamah-konstitusi_sidang_sengketa-pilpres-2024_amicus-curiae.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/60-pantun-idul-fitri-2024-yang-unik-dan-menarik-untuk-menyambut-hari-lebaran-1445-h.jpg height: 90 width: 120 description: 60-pantun-idul-fitri-2024-yang-unik-dan-menarik-untuk-menyambut-hari-lebaran-1445-h.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_pj-gubernur-kaltim-akmal-malik-menandatangani-surat-rotasi-jabatan.jpg height: 90 width: 120 description: 20240328_pj-gubernur-kaltim-akmal-malik-menandatangani-surat-rotasi-jabatan.jpg |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/tribunshopping.svg height: height attribute not set width: width attribute not set description: tribun shopping logo |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/redmi-13c-master-image.jpg height: 140 width: 220 description: 7 rekomendasi hp murah harga rp 1 jutaan yang bisa dibeli pakai uang thr |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/infinix-note-40-pro-master-1.jpg height: 140 width: 220 description: 5 keunggulan dan kelemahan infinix note 40 pro yang dibanderol rp 3 jutaan, apakah worth it? |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/posisi-ketinggian-ideal-meletakkan-televisi-yang-benar-di-kamar-tidur.jpg height: 140 width: 220 description: jangan asal diletakkan, posisi ketinggian ideal meletakkan televisi yang benar di kamar tidur |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/pero-termos-permos-stainless-vacuum-water-bottle-tumbler-500ml.jpg height: 140 width: 220 description: 7 rekomendasi vacuum tumbler yang siap temani mudik, bisa jaga suhu air lebih lama |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/ilustrasi-beragam-obat-warung-yang-sebaiknya-jangan-sembarang-diminum3.jpg height: 140 width: 220 description: dikit-dikit minum obat, awas ini 8 bahaya yang bisa mengintaimu |
|
https://asset-2.tstatic.net/shopping/foto/bank/thumbnails2/abaikan-rasa-pahitnya-9-manfaat-daun-pepaya-untuk-menjaga-kesehatan-tubuh.jpg height: 140 width: 220 description: abaikan rasa pahitnya, 9 manfaat daun pepaya untuk menjaga kesehatan tubuh |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_orang-tua-harvey-moeis.jpg height: 90 width: 120 description: 20240328_orang-tua-harvey-moeis.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20231214_anies-hotman.jpg height: 90 width: 120 description: 20231214_anies-hotman.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_saro-coffee-and-eatery-yang-berlokasi-di-kawasan-perumahan-sepinggan-pratama.jpg height: 90 width: 120 description: 20240328_saro-coffee-and-eatery-yang-berlokasi-di-kawasan-perumahan-sepinggan-pratama.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_polres-berau-saat-memusnahkan-barang-bukti-sabu.jpg height: 90 width: 120 description: 20240328_polres-berau-saat-memusnahkan-barang-bukti-sabu.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20230921_cpns-2023-dan-pppk.jpg height: 90 width: 120 description: 20230921_cpns-2023-dan-pppk.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_lapangan-mini-soccer-di-stadion-aji-imbut.jpg height: 69 width: 90 description: 20240328_lapangan-mini-soccer-di-stadion-aji-imbut.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_tribunkaltimconurila-firdaus.jpg height: 69 width: 90 description: 20240328_tribunkaltimconurila-firdaus.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240321_hak-angket_prabowo_megawati_pdip_jokowi.jpg height: 69 width: 90 description: 20240321_hak-angket_prabowo_megawati_pdip_jokowi.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240325_bupati-paser-fahmi-fadli-saat-membuka-musrenbang-rkpd-kabupaten-paser-tahun-2025.jpg height: 69 width: 90 description: 20240325_bupati-paser-fahmi-fadli-saat-membuka-musrenbang-rkpd-kabupaten-paser-tahun-2025.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240202_bpnt-2024.jpg height: 69 width: 90 description: 20240202_bpnt-2024.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328-kolase-tangkapan-layar-feels-instagram.jpg height: 69 width: 90 description: 20240328-kolase-tangkapan-layar-feels-instagram.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/90-link-pp-kucing-ramadhan.jpg height: 69 width: 90 description: 90-link-pp-kucing-ramadhan.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20231002_kemdikbudristek-cpns-2023.jpg height: 69 width: 90 description: 20231002_kemdikbudristek-cpns-2023.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_dkj.jpg height: 69 width: 90 description: 20240328_dkj.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/ratusan-polisi-razia-ketupat.jpg height: 69 width: 90 description: ratusan-polisi-razia-ketupat.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_gempa-gunung-kidul.jpg height: 90 width: 120 description: 20240328_gempa-gunung-kidul.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/tadarus-yang-rutin-dilakukan-muda-mudi-di-masjid-baabul-hafazah.jpg height: 90 width: 120 description: tadarus-yang-rutin-dilakukan-muda-mudi-di-masjid-baabul-hafazah.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/202440131_ilustrasi-pekerja-di-ikn.jpg height: 90 width: 120 description: 202440131_ilustrasi-pekerja-di-ikn.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/tanggapan-uah-soal-film-kiblat.jpg height: 90 width: 120 description: tanggapan-uah-soal-film-kiblat.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/sandra-dewi-harvey-moeis-jet-pribadi.jpg height: 90 width: 120 description: sandra-dewi-harvey-moeis-jet-pribadi.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240112_walikota-samarinda-andi-harun-1.jpg height: 90 width: 120 description: 20240112_walikota-samarinda-andi-harun-1.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328-puluhan-polisi-melaksanakan-apel-pagi-di-halaman-mapolres-bontang.jpg height: 90 width: 120 description: 20240328-puluhan-polisi-melaksanakan-apel-pagi-di-halaman-mapolres-bontang.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/sandra-dewi-dan-harvey-moeis_20161112_150117.jpg height: 90 width: 120 description: sandra-dewi-dan-harvey-moeis_20161112_150117.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328_bupati-kutai-timur-ardiansyah-sulaiman.jpg height: 90 width: 120 description: 20240328_bupati-kutai-timur-ardiansyah-sulaiman.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240210_pencoblosan_survei-capres-2024-terbaru-hari-ini_elektabilitas_pilpres-2024_pilpres-2019.jpg height: 90 width: 120 description: 20240210_pencoblosan_survei-capres-2024-terbaru-hari-ini_elektabilitas_pilpres-2024_pilpres-2019.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328-tenaga-honorer-di-lingkungan-pemkot-samarinda.jpg height: 90 width: 120 description: 20240328-tenaga-honorer-di-lingkungan-pemkot-samarinda.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240328-polresta-balikpapan-gelar-rapat-lintas-sektoral.jpg height: 90 width: 120 description: 20240328-polresta-balikpapan-gelar-rapat-lintas-sektoral.jpg |
|
https://asset-2.tstatic.net/kaltim/foto/bank/thumbnails2/20240320_whatsapp_cara-mengatasi-whatsapp-tak-bisa-busa-dibuka.jpg height: 90 width: 120 description: 20240320_whatsapp_cara-mengatasi-whatsapp-tak-bisa-busa-dibuka.jpg |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/tribunjualbeli.svg height: height attribute not set width: width attribute not set description: tribunjualbeli logo |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814756/1-1467837427-ruko-3-lantai-jalan-haji-nawi-raya--cilandak--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: ruko 3 lantai jalan haji nawi raya, cilandak, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814755/1-1791538353-rumah-minimalis--harga-ekonomis-di-sleman-thumb.jpg height: height attribute not set width: width attribute not set description: rumah minimalis, harga ekonomis di sleman |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814754/1-1268270988-ruko-graha-mas-fatmawati--kebayoran-baru--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: ruko graha mas fatmawati, kebayoran baru, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814751/1-538148637-lelang-rumah-jl.-samali-ujung--pasar-minggu--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: lelang rumah jl. samali ujung, pasar minggu, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814750/1-117222244-lelang-rumah-jl.-tebet-barat-dalam--tebet-barat--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: lelang rumah jl. tebet barat dalam, tebet barat, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814749/1-1359680653-dijual-rumah-murah--dekat-stadion-maguwo-di-ngemplak-thumb.jpg height: height attribute not set width: width attribute not set description: dijual rumah murah, dekat stadion maguwo di ngemplak |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814748/1-814022900-perusahaan-ekspedisi-door-to-door-cv-aiden-davinci-toni-logistik-thumb.jpg height: height attribute not set width: width attribute not set description: perusahaan ekspedisi door to door cv aiden davinci toni logistik |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814747/1-1857866977-rumah-idaman-investasi-cerdas-rumah-murah-di-borobudur-magelang-thumb.jpg height: height attribute not set width: width attribute not set description: rumah idaman investasi cerdas rumah murah di borobudur magelang |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814746/1-1243037947-ruko-3-lantai--jl.-bungur-besar-raya--kemayoran--jakarta-pusat-thumb.jpg height: height attribute not set width: width attribute not set description: ruko 3 lantai, jl. bungur besar raya, kemayoran, jakarta pusat |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2813134/1-1972644291-pasir-pasang-dan-pasir-cor-thumb.jpg height: height attribute not set width: width attribute not set description: pasir pasang pasir cor dan limestone |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814745/1-2093998474-ruko-2-lantai-di-jalan-raya-bekasi-dekat-pasar-induk-cipinang-thumb.jpg height: height attribute not set width: width attribute not set description: ruko 2 lantai di jalan raya bekasi dekat pasar induk cipinang |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814743/1-1314902702-perumahan-rancaekek-thumb.jpg height: height attribute not set width: width attribute not set description: perumahan rancaekek |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814740/1-685373758-perumahan-sindanglaya-arcamanik-thumb.jpg height: height attribute not set width: width attribute not set description: perumahan sindanglaya arcamanik |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814738/1-1012844185-rumah-2-lantai-sawangan-depok-thumb.jpg height: height attribute not set width: width attribute not set description: rumah 2 lantai sawangan depok |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814742/1-989775822-ruko-4-lantai--supomo-office-park--menteng-dalam--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: ruko 4 lantai, supomo office park, menteng dalam, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814739/1-1744028874-lelang-rumah-jl.-tebet-barat-4--tebet-barat--tebet--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: lelang rumah jl. tebet barat 4, tebet barat, tebet, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814737/1-1901328653-lelang-rumah-jl.-penganten-ali--ciracas--jakarta-timur-thumb.jpg height: height attribute not set width: width attribute not set description: lelang rumah jl. penganten ali, ciracas, jakarta timur |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814735/1-1305955040-termurah-lahan-jl.-keselamatan-ii--tebet--jakarta-selatan-thumb.jpg height: height attribute not set width: width attribute not set description: termurah lahan jl. keselamatan ii, tebet, jakarta selatan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814734/1-222533293-dijual-rumah-tipe-besar-di-purwomartani--kalasan-thumb.jpg height: height attribute not set width: width attribute not set description: dijual rumah tipe besar di purwomartani, kalasan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/3/2814732/1-1457169313-wujudkan-rumah-impian-cantik-minimalis-cuman-400-jutaan-di-magelang-thumb.jpg height: height attribute not set width: width attribute not set description: wujudkan rumah impian cantik minimalis cuman 400 jutaan di magelang |
|
https://b.scorecardresearch.com/p?c1=2&c2=8077308&cv=2.0&cj=1 height: height attribute not set width: width attribute not set description: comscore |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!