www.arla.se website review
Improve your SEO :: free trial!
www.arla.se is 81% geoptimaliseerd!
SEO Keyword summary for www.arla.se/recept/marinerad-kyckling/
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be och
Focus keyword
Short and long tail
Short Tail Keywords och min kyckling |
long Tail Keywords (2 words) 30 min min grillad grillad kyckling recept mat marinerad kyckling |
long Tail Keywords (3 words) 30 min grillad med kyckling mango sallad med kyckling min sallad med kyckling mango och mango och rtquinoa 41 30 min |
www.arla.se On-Page SEO Scan
Descriptive Elements
The <head> element of a www.arla.se/recept/marinerad-kyckling/ page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
marinerad kyckling recept arla
Meta description
Meta description legth
Meta description SEO
apelsin och rosmarin riktigt bra smakkombination marinera grna kycklingen ver natten maximal smak
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
arla marinerad kyckling kycklingsallad med och ost sallad mango rtquinoa grillad limone flskfil lime pitabrd coleslaw primrer provlagat mat httpswwwarlasereceptmarineradkyckling grddfil jrd beer can chicken quesadillas jalapeo koriander jerk kall rtss club sandwich arlakadabra pyssel kul falbygdens ostbutik hemleverans receptapp nyhetsbrev arlas webbshop konsumentforum facebook instagram youtube twitter
Mobile SEO www.arla.se/recept/marinerad-kyckling/
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for www.arla.se/recept/marinerad-kyckling/
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
11 characters long
Domain name SEO Impact
Path name
kyckling found in path !
marinerad found in path !
recept found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
HTML request without WWW redirected correctly?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
start
arlas kundportal
|
om-arla kontakta oss
nyheter press
jobb karrir
arla in other countries
fr gare
|
org konsumentforum
|
produkter arla ko grddfil
|
recept kycklingsallad med gg och ost
sallad med kyckling mango och rtquinoa
grillad kyckling al limone
grillad flskfil och kyckling med lime
kyckling i pitabrd med coleslaw p primrer
fler recept
beer can chicken
quesadillas med jalapeo kyckling och koriander
jerk chicken
kall rtss
club sandwich med grillad kyckling och sallad
arla mat receptapp
|
www.arla.se recept mat
produkter
hllbarhet
om arla
arlakadabra
nyhetsbrev
hlsa
event sponsring
aktuellt
integritetspolicy
om cookies
|
Links to external pages
Outloing links
www.arlawebbshop.se
www.arla.com
www.falbygdensost.se
www.arlawebbshop.se
assetfarm.arla.com
www.facebook.com
SEO Advice for www.arla.se
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 35 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 70% | The meta description should be between 145 and 160 characters. This meta description is 116 characters long. | |
Meta description relevance | 27% | Meta Description should reflect the contents of a site. This site has a 15 % match | |
Number of internal links | 100% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 63 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 4 level 1 folders and 10 folders above or in the first level of navigation. | |
Headings | 100% | Headers should reflect the contents of a site. This site has a 60 % match | |
Links | 64% | Link anchors should to some degree reflect the contents of a site. This site has a 32 % match | |
Image alt tags | 100% | Image alt tags should to some degree reflect the contents of a site. This site has a 40 % match | |
Bold and italic | 100% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 60 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 100% | All images on this page have been described. Great job ! | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 100% | An ideal page contains between 400 and 600 words.This page contains 432 words | |
Server response time | 30% | A slow server slows down a website. This server responds 257.93% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 39% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 17 inline style declarations ( <a style="color:green">) with a size of 184 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 1 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 100% | Perfect, we did not detect too many CSS files | |
Javascript | 30% | Wij detected too much (4) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.arla.se images and descriptions
31 images found at www.arla.se Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://www.arla.se/ui/img/arla-logo.a7388293.svg height: 36 width: 55 description: arla |
|
https://cdn-rdb.arla.com/files/arla-se/2987120959/89ad804d-8823-4207-a6db-4cf0a2ca928a.jpg?crop=(278,0,0,0)&w=375&h=265&mode=crop&ak=f525e733&hm=4b574910 height: height attribute not set width: width attribute not set description: marinerad kyckling |
|
https://cdn-rdb.arla.com/files/arla-se/2221221364/0d694045-7c06-4344-b4ae-09e6cec4d661.jpg?w=76&h=76&mode=crop&ak=f525e733&hm=08465086 height: height attribute not set width: width attribute not set description: kycklingsallad med ägg och ost |
|
https://cdn-rdb.arla.com/files/arla-se/1270492806/17b21b53-810e-4320-a20d-9337094ac8cf.jpg?w=76&h=76&mode=crop&ak=f525e733&hm=08465086 height: height attribute not set width: width attribute not set description: sallad med kyckling, mango och örtquinoa |
|
https://cdn-rdb.arla.com/files/arla-se/1774380297/c6c9514c-ce22-411c-927d-d867f45c7200.jpg?crop=(498,0,-402,0)&w=76&h=76&mode=crop&ak=f525e733&hm=2b3a06e5 height: height attribute not set width: width attribute not set description: grillad kyckling al limone |
|
https://cdn-rdb.arla.com/files/arla-se/560470464/e089c9ea-e623-4cdf-845e-8815e83c3d1b.jpg?w=76&h=76&mode=crop&ak=f525e733&hm=08465086 height: height attribute not set width: width attribute not set description: grillad fläskfilé och kyckling med lime |
|
https://cdn-rdb.arla.com/files/arla-se/80012706/d3212e34-8bd7-41fc-9561-8e6c7de5d782.jpg?w=76&h=76&mode=crop&ak=f525e733&hm=08465086 height: height attribute not set width: width attribute not set description: kyckling i pitabröd med coleslaw på primörer |
|
http://www.arla.se/4a366b/contentassets/2fb38596c7024a48a9881ab559c061d1/arlamat_logo_final.png?width=64&height=64 height: height attribute not set width: width attribute not set description: provlagat av arla mat |
|
http://www.arla.se/recept/marinerad-kyckling/qrcode.png height: height attribute not set width: width attribute not set description: https://www.arla.se/recept/marinerad-kyckling/ |
|
https://images.opv.se/v120/thumbnails/px50/shegjtqrkxwe7qrykt5zo7crdq000000.png height: height attribute not set width: width attribute not set description: arla ko® gräddfil |
|
https://adn-editor.arla.com/api/assets/arla-se/47265e56-da66-4f69-bf2c-87d7d10882eb/ height: height attribute not set width: width attribute not set description: arla jörd q1 2024 |
|
https://cdn-rdb.arla.com/files/arla-se/2221221364/0d694045-7c06-4344-b4ae-09e6cec4d661.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: kycklingsallad med ägg och ost |
|
https://cdn-rdb.arla.com/files/arla-se/1270492806/17b21b53-810e-4320-a20d-9337094ac8cf.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: sallad med kyckling, mango och örtquinoa |
|
https://cdn-rdb.arla.com/files/arla-se/1774380297/c6c9514c-ce22-411c-927d-d867f45c7200.jpg?crop=(0,142,0,0)&w=212&h=120&mode=crop&ak=f525e733&hm=22142f50 height: height attribute not set width: width attribute not set description: grillad kyckling al limone |
|
https://cdn-rdb.arla.com/files/arla-se/560470464/e089c9ea-e623-4cdf-845e-8815e83c3d1b.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: grillad fläskfilé och kyckling med lime |
|
https://cdn-rdb.arla.com/files/arla-se/80012706/d3212e34-8bd7-41fc-9561-8e6c7de5d782.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: kyckling i pitabröd med coleslaw på primörer |
|
https://cdn-rdb.arla.com/files/arla-se/588729887/e01c43b0-8b28-4e06-81d8-ce5d87bf2983.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: beer can chicken |
|
https://cdn-rdb.arla.com/files/arla-se/1979499984/a33c7624-c663-4fd0-bf87-102982938256.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: quesadillas med jalapeño, kyckling och koriander |
|
https://images.arla.com/recordid/9420bc5a-3093-4eef-807b86e44d3b8060/jerk-chicken.jpg?format=jpg&width=212&height=120&mode=crop height: height attribute not set width: width attribute not set description: jerk chicken |
|
https://cdn-rdb.arla.com/files/arla-se/4244314542/b553022b-1a99-4aa3-aa81-9b9acfd89168.jpeg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: kall örtsås |
|
https://cdn-rdb.arla.com/files/arla-se/622731496/d52ce7a7-bd77-4cc9-aa59-9a5839b99a4e.jpg?w=212&h=120&mode=crop&ak=f525e733&hm=caa68da6 height: height attribute not set width: width attribute not set description: club sandwich med grillad kyckling och sallad |
|
http://www.arla.se/4a9c18/globalassets/settings/sidfot/footer-arlakadabra-pyssel-200x200.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: arlakadabra – pyssel och kul |
|
http://www.arla.se/49b89c/globalassets/settings/sidfot/falbygdens-ost-footer-250x92.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: falbygdens ost – ostbutik med hemleverans |
|
http://www.arla.se/4a4af8/globalassets/logotyper/460x460/arlamat_logo_final-460x460.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: arla mat – receptapp |
|
http://www.arla.se/4a243f/globalassets/settings/sidfot/nyhetsbrev-5-ikoner-200x200.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: nyhetsbrev |
|
http://www.arla.se/4a9c18/globalassets/settings/sidfot/footer-arlas-webbshop-sidfot-ikon-200x200.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: arlas webbshop |
|
http://www.arla.se/4a9c18/globalassets/settings/sidfot/footer-kundo-sidfot-ikon-200x200.png?width=125&height=46&rmode=max height: height attribute not set width: width attribute not set description: konsumentforum |
|
http://www.arla.se/48f150/globalassets/settings/sociala-medier/facebook-light-gray.svg height: 24 width: 24 description: facebook |
|
http://www.arla.se/48f150/globalassets/settings/sociala-medier/instagram-light-gray.svg height: 24 width: 24 description: instagram |
|
http://www.arla.se/48f150/globalassets/settings/sociala-medier/youtube-light-gray.svg height: 24 width: 24 description: youtube |
|
http://www.arla.se/48f150/globalassets/settings/sociala-medier/twitter-light-gray.svg height: 24 width: 24 description: twitter |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!