www.kompas.tv website review
![](/include/images/menno/screenl1.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/screenl2.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/highlight.png)
Improve your SEO :: free trial!
www.kompas.tv is 55% geoptimaliseerd!
SEO Keyword summary for www.kompas.tv/internasional/508336/pria-bunuh-2-polisi-di-kantor-kepolisian-malaysia-diduga-serangan-jemaah-islamiyah
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be polisi
Focus keyword
Short and long tail
Short Tail Keywords polisi dan untuk |
long Tail Keywords (2 words) juni 2024 17 juni kantor polisi jemaah islamiyah polisi di |
long Tail Keywords (3 words) 17 juni 2024 kantor polisi di teki santuy eps internasional kompas dunia teka teki santuy tts teka teki perbankan loker olahraga |
www.kompas.tv On-Page SEO Scan
Descriptive Elements
The <head> element of a www.kompas.tv/internasional/508336/pria-bunuh-2-polisi-di-kantor-kepolisian-malaysia-diduga-serangan-jemaah-islamiyah page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
pria bunuh polisi kantor kepolisian malaysia diduga serangan jemaah islamiyah
Meta description
Meta description legth
Meta description SEO
lima anggota keluarganya yang diyakini sebagai ditangkap untuk penyelidikan kata kepala polisi nasional malaysia razarudin husain
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wwwkompastv logo kompascom lestari priabunuh polisidikantorkepolisianmalaysiadidugaseranganjemaahislamiyah kompas play ikuti kuisnya dapatkan hadiahnya ayo tantang pikiranmu dan perluas pengetahuanmu siap untuk menjawab panggilan sejarah ikutan sekarang temukan jawaban tekateki silang kuliner dari berbagai negara dunia apakahdagingkurbanbolehdiperjualbelikaninipenjelasanmui momenprabowosalatiduladhabersamawargahambalangbogor dengarkabarrubenonsugugatceraisarwendahirfanhakimkirimpesanwhatsappyangsabarya liburiduladhawisatalembangdankebunbinatangsurabayajadidestinasifavoritwarga aniessebutpenyaluranbantuanuntuklansiakjphinggakjmudijakartaharusdiperbaiki podcastskenanyamengenalcikalbakalmusikska tone lafranfilmbiopikpendirihmibakaltayangpada juni menakerkemensosperlukajimanfaatdanmudaratpemberianbansoskepadakorbanjudionline polisibeberkanalasanbelumpanggiltikoaryawardhana ahokbenarkanadanamaaniesbaswedandiusulkandpdpdipuntukpilkadajakarta
Mobile SEO www.kompas.tv/internasional/508336/pria-bunuh-2-polisi-di-kantor-kepolisian-malaysia-diduga-serangan-jemaah-islamiyah
Mobile rendering
![](/include/images/menno/screenl1.png)
![](/include/images/menno/screenl2.png)
![](/include/images/menno/highlight.png)
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
![](/include/images/icons/loader.gif)
![](/include/images/icons/loader.gif)
Marketing / lead generation for www.kompas.tv/internasional/508336/pria-bunuh-2-polisi-di-kantor-kepolisian-malaysia-diduga-serangan-jemaah-islamiyah
Social Media
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
![seo tip:](http://www.webcijfers.nl/include/images/icons/alert.png)
SERP Link
SERP Description
Domain Level SEO
Domain name
13 characters long
Domain name SEO Impact
Path name
islamiyah found in path !
jemaah found in path !
kantor found in path !
malaysia found in path !
nasional found in path !
polisi found in path !
pria found in path !
serangan found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Favicon icon found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
HTML request without WWW redirected correctly?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Robots.txt found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Sitemap found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
kompas tv
selengkapnya
lihat semua
|
editor desy afrianti
|
ekonomi ekonomi dan bisnis
energi
keuangan
properti
perbankan
loker
|
entertainment selebriti
film
musik
seni budaya
komedi
/515843/dengar-kabar-ruben-onsu-gugat-cerai-sarwendah-irfan-hakim-kirim-pesan-whatsapp-yang-sabar-ya
dengar kabar ruben onsu gugat cerai sarwendah irfan hakim kirim pesan whatsapp yang sabar ya
selebriti
podcast skenanya mengenal cikal bakal musik ska 2 tone
musik
lafran film biopik pendiri hmi bakal tayang pada 20 juni 2024
film
polisi beberkan alasan belum panggil tiko aryawardhana
ruben onsu gugat cerai sarwendah jordi onsu khawatirkan kondisi betrand peto
|
internasional kompas dunia
datatitle
pm malaysia anwar ibrahim bertemu pemimpin hamas di qatar apa yang dibahas
lihat semua komentar
|
kolom opini
opini kompasianer
|
kuis menangkan jutaan rupiah lewat kuis kompastv
|
legal.kompas.tv privacy
|
lifestyle tren
kesehatan
travel
kuliner
beauty and fashion
tips mengolah daging kurban rendah lemak dan kolesterol
|
login |
nasional politik
hukum
peristiwa
humaniora
rumah pemilu
anies sebut penyaluran bantuan untuk lansia kjp hingga kjmu di jakarta harus diperbaiki
rumah pemilu
menaker kemensos perlu kaji manfaat dan mudarat pemberian bansos kepada korban judi online
humaniora
ahok benarkan ada nama anies baswedan diusulkan dpd pdip untuk pilkada jakarta 2024
peristiwa
klarifikasi menko pmk soal bansos untuk korban judi online ditujukan untuk keluarga bukan pelaku
|
olahraga sepak bola
badminton
motogp
f1
sports
|
partner |
penulis edwin shri bimo
|
regional jabodetabek
banten
jawa barat
jawa tengah diy
jawa timur
kalimantan
sulawesi
sumatra
bali nusa tenggara
papua maluku
berita daerah
|
register |
religi apakah daging kurban boleh diperjualbelikan ini penjelasan mui
beranda islami
ketua umum pp muhammadiyah haedar nashir berkurban menunaikan kebajikan dan ketakwaan
catat berikut bacaan doa dan tata cara menyembelih hewan kurban iduladha 2024
|
saintek sains
teknologi
|
tag malaysia
polisi malaysia
serangan
jamaah islamiyah
ulu tiram
|
talkshow rosi
satu meja
dua arah
lanturan
livi on point
kode
|
video vod
top 3 news
ni luh
opini budiman
60 special report
sinau
momen prabowo salat iduladha bersama warga hambalang bogor
vod
libur idul adha wisata lembang dan kebun binatang surabaya jadi destinasi favorit warga
ayah eky jadi sorotan adakah kemungkinan iptu rudiana kembali diperiksa
2 rekan pegi diperiksa untuk buktikan jejak komunikasi digital keberadaan pegi di 2016
kesaksian liga akbar bisa ringankan pegi di praperadilan
momen iduladha 2024 gibran sumbang sapi berbobot 1 ton ke masjid istiqlal jakarta
presiden jokowi akan melaksanakan salat iduladha di masjid baiturrahman semarang
ditanya pilkada jakarta kaesang kalau melihat survei yang realistis ya dengan pak anies
gudang pengoplosan elpiji meledak tewaskan 12 orang pemilik gudang jadi tersangka
liga akbar minta ayah eky jujur terkait kasus pembunuhan anaknya 8 tahun silam
cerita jurnalis kompastv terjebak macet dan jalan kaki ke lokasi dekat lempar jumrah
hari raya iduladha prabowo bagikan 48 sapi untuk warga bogor
|
www.kompas.tv live tv
tv digital
our anchors
nasional
regional
video
talk show
pertamina talks
internasional
ekonomi
olahraga
entertainment
lifestyle
saintek
kolom
about us
cyber media guidelines
contact us
career
|
Links to external pages
Outloing links
www.kompas.com
www.kompasiana.com
www.tribunnews.com
www.kontan.co.id
www.bolasport.com
www.grid.id
www.gridoto.com
www.gramedia.com
www.kgmedia.id
www.esgpositiveimpactconsortium.asia
www.facebook.com
SEO Advice for www.kompas.tv
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 91% | A title should reflect the contents of a site. This site has a 70 % match | |
Title Length | 70% | Limit your title to anywhere between 40 and 70 characters. Your title was 84 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 85% | The meta description should be between 145 and 160 characters. This meta description is 143 characters long. | |
Meta description relevance | 90% | Meta Description should reflect the contents of a site. This site has a 50 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 213 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 19 level 1 folders and 50 folders above or in the first level of navigation. | |
Headings | 21% | Headers should reflect the contents of a site. This site has a 9 % match | |
Links | 14% | Link anchors should to some degree reflect the contents of a site. This site has a 7 % match | |
Image alt tags | 31% | Image alt tags should to some degree reflect the contents of a site. This site has a 11 % match | |
Bold and italic | 39% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 13 % match | |
Html ratio | 40% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 72% | 72.413793103448 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 55% | An ideal page contains between 400 and 600 words.This page contains 1194 words | |
Server response time | 30% | A slow server slows down a website. This server responds 593.67% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 14% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 24 inline style declarations ( <a style="color:green">) with a size of 867 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 3 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (11) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (23) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.kompas.tv images and descriptions
12 images found at www.kompas.tv Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=ng4xp1iw1d10t3 height: 1 width: 1 description: no alt description found |
|
https://media.kompas.tv/frontend/img.png height: 124 width: 221 description: ahok-benarkan-ada-nama-anies-baswedan-diusulkan-dpd-pdi-p-untuk-pilkada-jakarta-2024 |
|
https://media.kompas.tv/webassets/assets_v1/365x100web.png height: 68 width: 250 description: www.kompas.tv |
|
https://media.kompas.tv/webassets/assets_v1/kompastv.png height: 51px width: 180px description: www.kompas.tv |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_muter.gif height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_biruv2.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_putih.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-pln.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-signify-v2.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/library/image/content_article/article_img/20230406141828.jpg height: height attribute not set width: 100% description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-asia-sustainability-new.png height: height attribute not set width: width attribute not set description: no alt description found |
|
http://www.kompas.tv/ height: 22 width: 197 description: kompas tv play |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!