www.kompas.tv website review
Improve your SEO :: free trial!
www.kompas.tv is 54% geoptimaliseerd!
SEO Keyword summary for www.kompas.tv/nasional/508326/vina-setelah-film-ditayangkan-iii-kesaksian-keluarga-ibu-pekerja-migran-dan-ayah-polisi?medium=newstrending&so=3
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be vina
Focus keyword
Short and long tail
Short Tail Keywords vina dan kompas |
long Tail Keywords (2 words) 9 juni juni 2024 wib vod kompas dunia rental mobil |
long Tail Keywords (3 words) 9 juni 2024 ekonomi dan bisnis bos rental mobil teki santuy eps teka teki santuy tts teka teki dunia ekonomi ekonomi |
www.kompas.tv On-Page SEO Scan
Descriptive Elements
The <head> element of a www.kompas.tv/nasional/508326/vina-setelah-film-ditayangkan-iii-kesaksian-keluarga-ibu-pekerja-migran-dan-ayah-polisi?medium=newstrending&so=3 page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
vina setelah film ditayangkan iii kesaksian keluarga ibu pekerja migran dan ayah polisi
Meta description
Meta description legth
Meta description SEO
selainkebrutalan geng motor filmvina sebelum harijuga mengungkap sosok ibu vina yaitu sukaesih yang bekerja malaysia sebagai pekerja migran
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wwwkompastv logo kompascom lestari vinasetelahfilmditayangkaniiikesaksiankeluargaibupekerjamigrandanayahpolisi kompas play ikuti kuisnya dapatkan hadiahnya ayo tantang pikiranmu dan perluas pengetahuanmu siap untuk menjawab panggilan sejarah ikutan sekarang temukan jawaban tekateki silang kuliner dari berbagai negara dunia prakiraancuacajabodetabekminggu juni hujanringanguyursebagianwilayah catatinijadwalperjalanan keretaapitambahanuntukliburpanjangiduladha damrihadirkanlayananangkutanstasiunmadiunpantaiklayarpacitanpptiketnyarp tuntutankemerdekaandariwilayahjajahanprancissemakinmenggemaparismumet kaliledakansaatkebakarangudangtinerditangerangwargapanik balaspujiandaripuanmaharanianiespdipjugamenarik israelmasukdaftarhitampenyiksaanakdubeserdanngamukusulkanunrwajadiorganisasiteroris pdipdananiessalingpujipksaniespunyakapasitasuntukmenang didugabelisabuuntukkonsumsipribadiketuadpdpsibatamdan rekannyaditangkap polisitangkap pelakupengeroyokanbosrentalmobilhinggatewasdipati
Mobile SEO www.kompas.tv/nasional/508326/vina-setelah-film-ditayangkan-iii-kesaksian-keluarga-ibu-pekerja-migran-dan-ayah-polisi?medium=newstrending&so=3
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for www.kompas.tv/nasional/508326/vina-setelah-film-ditayangkan-iii-kesaksian-keluarga-ibu-pekerja-migran-dan-ayah-polisi?medium=newstrending&so=3
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
The title is trucated
SERP Link
SERP Description
Domain Level SEO
Domain name
13 characters long
Domain name SEO Impact
Path name
dan found in path !
film found in path !
ibu found in path !
nasional found in path !
polisi found in path !
vina found in path !
yang found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
HTML request without WWW redirected correctly?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
kompas tv
selengkapnya
lihat semua
|
editor edy a putra
|
ekonomi ekonomi dan bisnis
energi
keuangan
properti
perbankan
loker
catat ini jadwal perjalanan 18 kereta api tambahan untuk libur panjang iduladha
ekonomi dan bisnis
|
entertainment selebriti
film
musik
seni budaya
komedi
|
internasional kompas dunia
tuntutan kemerdekaan dari wilayah jajahan prancis semakin menggema paris mumet
kompas dunia
israel masuk daftar hitam penyiksa anak dubes erdan ngamuk usulkan unrwa jadi organisasi teroris
israel masuk daftar hitam penyiksa anak dubes erdan ngamuk usulkan unrwa jadi organisasi teroris
israel klaim tewaskan 17 personel hamas di sekolah pbb otoritas gaza bantah semuanya warga sipil
korban terbunuhserangan israel di gaza tengah melonjakjadi 210 warga sipil
|
kolom opini
opini kompasianer
|
kuis menangkan jutaan rupiah lewat kuis kompastv
|
legal.kompas.tv privacy
|
lifestyle tren
kesehatan
travel
kuliner
beauty and fashion
damri hadirkan layanan angkutan stasiun madiunpantai klayar pacitan pp tiketnya rp28200
travel
|
login |
nasional politik
hukum
peristiwa
humaniora
rumah pemilu
datatitle
show all
|
olahraga sepak bola
badminton
motogp
f1
sports
|
partner |
penulis iman firdaus
|
regional jabodetabek
banten
jawa barat
jawa tengah diy
jawa timur
kalimantan
sulawesi
sumatra
bali nusa tenggara
papua maluku
berita daerah
polisi sebut 8 pembunuh vina cirebon sempat cabut bap kini dalami alasan dan dugaan intervensi
prakiraan cuaca jabodetabek minggu 9 juni 2024 hujan ringan guyur sebagian wilayah
jabodetabek
|
register |
saintek sains
teknologi
|
tag keluarga vina cirebon
kasus vina cirebon
keluarga vina
film vina
vina
pembunuhan vina
|
talkshow rosi
satu meja
dua arah
lanturan
livi on point
kode
basuki jadi plt kepala otorita penggagas ikn berat rosi
ormas dapat jatah tambang mantan kepala bappenas itu bukan urusannya rosi
pimpinan otorita mundur penggagas ikn duga ada target berlebihan rosi
|
video vod
top 3 news
ni luh
opini budiman
60 special report
sinau
3 kali ledakan saat kebakaran gudang tiner di tangerang warga panik
vod
balas pujian dari puan maharani anies pdip juga menarik
pdip dan anies saling puji pks anies punya kapasitas untuk menang
diduga beli sabu untuk konsumsi pribadi ketua dpd psi batam dan 2 rekannya ditangkap
polisi tangkap 2 pelaku pengeroyokan bos rental mobil hingga tewas di pati
dikira maling bos rental mobil di pati tewas dipukuli warga
demi uang seorang ibu tega cabuli anak kandungnya
saksi liga akbar sebut eky sempat tunjukan foto pria yang bermasalah dengannya
lakukan klarifikasi satpam mal viral pukul anjing menangis sampaikan permintaan maaf
kata polisi soal kasus bos rental mobil tewas dikeroyoki warga di pati
facebook icha shakila disebut perintah ibu cabuli anak kandung di cileungsi
respons gibran ketika ditanya pdip ingin usung cawagub untuk khofifah
|
www.kompas.tv live tv
tv digital
our anchors
nasional
regional
video
talk show
pertamina talks
internasional
ekonomi
olahraga
entertainment
lifestyle
saintek
kolom
about us
cyber media guidelines
contact us
career
|
Links to external pages
Outloing links
www.kompas.com
www.kompasiana.com
www.tribunnews.com
www.kontan.co.id
www.bolasport.com
www.grid.id
www.gridoto.com
www.gramedia.com
www.kgmedia.id
play.kompas.com
www.facebook.com
SEO Advice for www.kompas.tv
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 49% | A title should reflect the contents of a site. This site has a 38 % match | |
Title Length | 70% | Limit your title to anywhere between 40 and 70 characters. Your title was 93 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 100% | The meta description should be between 145 and 160 characters. This meta description is 155 characters long. | |
Meta description relevance | 40% | Meta Description should reflect the contents of a site. This site has a 22 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 214 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 18 level 1 folders and 46 folders above or in the first level of navigation. | |
Headings | 23% | Headers should reflect the contents of a site. This site has a 10 % match | |
Links | 22% | Link anchors should to some degree reflect the contents of a site. This site has a 11 % match | |
Image alt tags | 42% | Image alt tags should to some degree reflect the contents of a site. This site has a 15 % match | |
Bold and italic | 60% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 20 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 78% | 77.777777777778 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 60% | An ideal page contains between 400 and 600 words.This page contains 933 words | |
Server response time | 30% | A slow server slows down a website. This server responds 562.38% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 14% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 24 inline style declarations ( <a style="color:green">) with a size of 867 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 1 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (10) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (23) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.kompas.tv images and descriptions
10 images found at www.kompas.tv Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=ng4xp1iw1d10t3 height: 1 width: 1 description: no alt description found |
|
https://media.kompas.tv/frontend/img.png height: 124 width: 221 description: polisi-tangkap-2-pelaku-pengeroyokan-bos-rental-mobil-hingga-tewas-di-pati |
|
https://media.kompas.tv/webassets/assets_v1/365x100web.png height: 68 width: 250 description: www.kompas.tv |
|
https://media.kompas.tv/webassets/assets_v1/kompastv.png height: 51px width: 180px description: www.kompas.tv |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_muter.gif height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_biruv2.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_putih.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-pln.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-signify-v2.png height: height attribute not set width: width attribute not set description: no alt description found |
|
http://www.kompas.tv/ height: 22 width: 197 description: kompas tv play |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!