www.kompas.tv website review
Improve your SEO :: free trial!
www.kompas.tv is 54% geoptimaliseerd!
SEO Keyword summary for www.kompas.tv/nasional/509365/dkpp-periksa-ketua-kpu-ri-atas-kasus-dugaan-pelecehan-seksual-ke-ppln-hari-ini
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be juni
Focus keyword
Short and long tail
Short Tail Keywords juni wib dkpp |
long Tail Keywords (2 words) 15 juni juni 2024 ketua kpu sepak bola pilgub jakarta |
long Tail Keywords (3 words) 15 juni 2024 ketua kpu ri teki santuy eps teka teki santuy ekonomi dan bisnis pelecehan seksual ke tts teka teki |
www.kompas.tv On-Page SEO Scan
Descriptive Elements
The <head> element of a www.kompas.tv/nasional/509365/dkpp-periksa-ketua-kpu-ri-atas-kasus-dugaan-pelecehan-seksual-ke-ppln-hari-ini page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
dkpp periksa ketua kpu atas kasus dugaan pelecehan seksual ppln hari ini
Meta description
Meta description legth
Meta description SEO
dkpp periksa ketua kpu atas kasus dugaan pelecehan seksual ppln hari ini
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wwwkompastv logo kompascom lestari dkppperiksaketuakpuriataskasusdugaanpelecehanseksualkepplnhariini kompas play ikuti kuisnya dapatkan hadiahnya ayo tantang pikiranmu dan perluas pengetahuanmu siap untuk menjawab panggilan sejarah ikutan sekarang temukan jawaban tekateki silang kuliner dari berbagai negara dunia psissemarangperpanjangkontrakkiperrizkydarmawan musimkedepan wanitadiacehtimurtemukanibunyatewasdirumahsekujurtubuhnyapenuhluka komisiviiidprawasipelaksanakaanibadahhaji ligaakbarungkapmerasabersalahhinggaalasaningincabutketeranganbapkasusvinacirebon indonesiatelevisiawards hadirkan nominasiprogramterbaik spalettisebutitaliatakterbebanistatusjuarabertahaneuroraksasatidaktakut bulogsiapjalankanpenugasanpemerintahuntukinvestasilahanpertaniandikamboja beginisituasijemaahhajiindonesiajelangwukufdiarafah irishbellakomentarirehabilitasiyangbakaldijalaniammarzoni inirencanadetailpinjamang senilairp triliununtukukrainauangnyabuatapasaja
Mobile SEO www.kompas.tv/nasional/509365/dkpp-periksa-ketua-kpu-ri-atas-kasus-dugaan-pelecehan-seksual-ke-ppln-hari-ini
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for www.kompas.tv/nasional/509365/dkpp-periksa-ketua-kpu-ri-atas-kasus-dugaan-pelecehan-seksual-ke-ppln-hari-ini
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
The title is trucated
SERP Link
SERP Description
Domain Level SEO
Domain name
13 characters long
Domain name SEO Impact
Path name
dkpp found in path !
dugaan found in path !
ini found in path !
kasus found in path !
ketua found in path !
kpu found in path !
nasional found in path !
ppln found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
HTML request without WWW redirected correctly?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
kompas tv
selengkapnya
lihat semua
|
editor desy afrianti
|
ekonomi ekonomi dan bisnis
energi
keuangan
properti
perbankan
loker
bulog siap jalankan penugasan pemerintah untuk investasi lahan pertanian di kamboja
ekonomi dan bisnis
kerja 1 bulan gaji rp1 juta begini syarat tugas dan jadwal pendaftaran pantarlih pilkada 2024
|
entertainment selebriti
film
musik
seni budaya
komedi
indonesia televisi awards 2024 hadirkan 12 nominasi program terbaik
film
irish bella komentari rehabilitasi yang bakal dijalani ammar zoni
selebriti
|
internasional kompas dunia
ini rencana detail pinjaman g7 senilai rp815 triliun untuk ukraina uangnya buat apa saja
kompas dunia
israel larang calon jemaah haji palestina dari gaza pergi ke makkah imbas rafah dikuasai zionis
lebih dari 2 juta jemaah haji tiba di mina 34000 petugas medis dan administrasi disiagakan
|
kolom opini
opini kompasianer
|
kuis menangkan jutaan rupiah lewat kuis kompastv
|
legal.kompas.tv privacy
|
lifestyle tren
kesehatan
travel
kuliner
beauty and fashion
|
login |
nasional politik
hukum
peristiwa
humaniora
rumah pemilu
datatitle
ketua kpu dilaporkan ke dkpp atas tuduhan dugaan pelecehan seksual ke anggota ppln
lihat semua komentar
mui soal wacana bansos untuk penjudi tak ada istilah korban dalam judi
|
olahraga sepak bola
badminton
motogp
f1
sports
psis semarang perpanjang kontrak kiper rizky darmawan 2 musim ke depan
sepak bola
spaletti sebut italia tak terbebani status juara bertahan euro raksasa tidak takut
|
partner |
penulis fadel prayoga
|
regional jabodetabek
banten
jawa barat
jawa tengah diy
jawa timur
kalimantan
sulawesi
sumatra
bali nusa tenggara
papua maluku
berita daerah
wanita di aceh timur temukan ibunya tewas di rumah sekujur tubuhnya penuh luka
sumatra
prakiraan cuaca jabodetabek sabtu 15 juni 2024 bmkg prediksi hujan sedang dan petir terjadi
|
register |
saintek sains
teknologi
|
tag kpu
hasyim asyari
dkpp
pelecehan seksual
ppln
david yama
|
talkshow rosi
satu meja
dua arah
lanturan
livi on point
kode
|
video vod
top 3 news
ni luh
opini budiman
60 special report
sinau
razia juru parkir liar di jakpus 6 orang ditangkap petugas gabungan
komisi viii dpr awasi pelaksanakaan ibadah haji 2024
vod
liga akbar ungkap merasa bersalah hingga alasan ingin cabut keterangan bap kasus vina cirebon
begini situasi jemaah haji indonesia jelang wukuf di arafah
dapat dukungan pkb ke pilgub jakarta anies akui komunikasi dengan pdip berjalan intensif
suasana tegang hizbullah bombardir roket drone dari lebanon ke israel
soal penanganan kasus harun masiku pengamat ada politik di kpk
kata anies soal pilgub jakarta 2024 komunikasi dengan pdip intensif
analisis peluang di pilgub jakarta pengamat kalau kaesang gabung anies pdip hengkang
jelang wukuf di arafah timwas haji dpr temukan tenda tak sesuai jumlah jemaah
isi obrolan menhan prabowo ketemu menlu as di yordania
apa yang buat gerindra yakin menang dari anies baswedan di pilgub jakarta
pengacara pegi setiawan siapkan bukti digital dari status facebook kliennya
polisi tangkap 4 perampok jam tangan mewah rp128 m di kawasan pik 2
|
www.kompas.tv live tv
tv digital
our anchors
nasional
regional
video
talk show
pertamina talks
internasional
ekonomi
olahraga
entertainment
lifestyle
saintek
kolom
about us
cyber media guidelines
contact us
career
|
Links to external pages
Outloing links
www.kompas.com
www.kompasiana.com
www.tribunnews.com
www.kontan.co.id
www.bolasport.com
www.grid.id
www.gridoto.com
www.gramedia.com
www.kgmedia.id
www.esgpositiveimpactconsortium.asia
www.facebook.com
SEO Advice for www.kompas.tv
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 75% | A title should reflect the contents of a site. This site has a 57 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 79 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 60% | The meta description should be between 145 and 160 characters. This meta description is 81 characters long. | |
Meta description relevance | 100% | Meta Description should reflect the contents of a site. This site has a 57 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 215 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 18 level 1 folders and 50 folders above or in the first level of navigation. | |
Headings | 21% | Headers should reflect the contents of a site. This site has a 9 % match | |
Links | 18% | Link anchors should to some degree reflect the contents of a site. This site has a 9 % match | |
Image alt tags | 36% | Image alt tags should to some degree reflect the contents of a site. This site has a 13 % match | |
Bold and italic | 54% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 18 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 75% | 75 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 60% | An ideal page contains between 400 and 600 words.This page contains 947 words | |
Server response time | 30% | A slow server slows down a website. This server responds 732.67% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 14% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 24 inline style declarations ( <a style="color:green">) with a size of 867 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 3 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (11) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (23) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.kompas.tv images and descriptions
11 images found at www.kompas.tv Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=ng4xp1iw1d10t3 height: 1 width: 1 description: no alt description found |
|
https://media.kompas.tv/frontend/img.png height: 124 width: 221 description: ini-rencana-detail-pinjaman-g7-senilai-rp815-triliun-untuk-ukraina-uangnya-buat-apa-saja |
|
https://media.kompas.tv/webassets/assets_v1/365x100web.png height: 68 width: 250 description: www.kompas.tv |
|
https://media.kompas.tv/webassets/assets_v1/kompastv.png height: 51px width: 180px description: www.kompas.tv |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_muter.gif height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_biruv2.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_putih.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-pln.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-signify-v2.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-asia-sustainability-new.png height: height attribute not set width: width attribute not set description: no alt description found |
|
http://www.kompas.tv/ height: 22 width: 197 description: kompas tv play |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!