en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 58% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/civil_service_rifles_war_memorial
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be war
Focus keyword
Short and long tail
Short Tail Keywords war memorial civil |
long Tail Keywords (2 words) civil service service rifles war memorial somerset house rifles war |
long Tail Keywords (3 words) civil service rifles service rifles war prince of wales rifles war memorial wales own civil first world war own civil service |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/civil_service_rifles_war_memorial page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
civil service rifles war memorial wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia featured article wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/civil_service_rifles_war_memorial
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/civil_service_rifles_war_memorial
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
civil found in path !
memorial found in path !
rifles found in path !
service found in path !
war found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlecivilservicerifleswarmemorialoldid1226708244
page information
printable version
|
wiki coordinates
somerset house
sir edwin lutyens
listed building
first world war memorial
central london
england
sir edwin lutyens
15th county of london battalion the london regiment
territorial force
civil service
queens westminster rifles
edward prince of wales
union flag
battle honours
remembrance sunday
first world war
historic england
country houses
the cenotaph
whitehall
imperial war graves commission
edward prince of wales
british army
4th london brigade
2nd london division
camp
salisbury plain
hertfordshire
western front
le havre
140th 4th london brigade
47th london division
battle of loos
battle of the somme
ypres
hundred days offensive
salonika
palestine
herbert baker
office of works
george iii
sir william chambers
portland stone
cornice
plinth
urn
swags
union flag
polychromy
treaty of versailles
festubert
flerscourcelette
doiran
lyskemmel
nebi samwil
jerusalem
st quentin
albert
ancre
bapaume
selle
transloy
messines
cambrai
nine elms stone masonry works
battersea
welsh guards
st clement danes
last post
reveille
god save the king
bishop of willesden
william perrin
guard of honour
hm treasury
german bombing
second world war
house of lords
lord houghton of sowerby
lord skelmersdale
embankment
river thames
royal green jackets
richard chartres
bishop of london
inland revenue
grade ii listed buildings in the city of westminster az
grade ii listed war memorials in england
national heritage list for england
war memorials register
imperial war museums
the times
pevsner nikolaus
the buildings of england
new haven connecticut
yale university press
isbn
dallington
barnsley
pen and sword books
frances lincoln publishers
liverpool university press
public art and memorials in london
britishenglishroyalty
boudica
alfred the great
richard i
queen eleanor charing cross
oliver cromwell
stocks market
kensington palace
westminster
kings cross
trafalgar square
duke of york
duke of kent
duke of cambridge
kensington palace
victoria memorial
albert memorial
memorial to the great exhibition
george v
george vi and queen elizabeth
john betjeman
marc bolan
robert burns
thomas carlyle
charlie chaplin
poets fountain
agatha christie
john donne
henry irving
michael jackson
george orwell
joshua reynolds
heminges and condell memorial
leicester square
arthur sullivan
oscar wilde
amy winehouse
james cook
yuri gagarin
john cass
thomas guy
quintin hogg
robert milligan
hugh myddelton
lord alanbrooke
lord badenpowell
ferdinand foch
charles george gordon
earl haig
henry havelock
lord kitchener
lord montgomery
lord mountbatten
charles james napier
admiral lord nelson nelsons column
james outram
lord roberts
viscount slim
hyde park corner
george stuart white
lord wolseley
edith cavell
florence nightingale
mary seacole
clement attlee
george canning
parliament square
benjamin disraeli
david lloyd george
william ewart gladstone
lord palmerston
robert peel
robert clayton
robert clive
duke of devonshire
charles james fox
henry bartle frere
sidney herbert
wilfrid lawson
simon milton paddington st jamess southwark
marquess of westminster
simn bolvar
bloomsbury
westminster
charles de gaulle
haile selassie
john f kennedy
nelson mandela
karl marx
peter the great
jos de san martn
jan smuts
volodymyr
george washington
thomas becket
john henry newman
shoreditch
joseph bazalgette
isambard kingdom brunel
sigmund freud
james henry greathead
nigel gresley
edward jenner
joseph lister
isaac newton
robert stephenson
thomas barnardo
millicent fawcett
margaret macdonald
emmeline and christabel pankhurst
sylvia pankhurst
robert raikes
raoul wallenberg
harry kane
upton parkwith geoff hurst martin peters and ray wilson
wembley
paddington bear
peter pan
sherlock holmes
talking statues
7 july bombings
queen alexandra
antiair war
bali bombings
lady burdettcoutts
lord cheylesmore
cleopatras needle
conscientious objectors
covid19 pandemic
michael faraday
firefighters
w g grace
golden boy of pye corner
the monument
heroic selfsacrifice
journalists
queen elizabeth gate
silver jubilee crystal crown
star and garter home
stratford martyrs
suffragettes
virginia quay settlers monument
wellington arch
wellington monument
whittington stone
custard apple annonaceae breadfruit moraceae and soursop annonaceae
national windrush monument
mary wollstonecraft
animals in war
guards brigade crimean war
gurkhas
marble arch
new zealand campaign 18631864
siege of cdiz
westminster school
61st battery royal field artillery woolwich
barnet boys school
royal artillery the mall
royal marines
africa and the caribbean
australia
battle of britain
belgium
blood swept lands and seas of red
burma railway
canada
la dlivrance
flanders fields memorial garden
memorial gates
merchant navy
ships named on the memorial
new zealand
poland
south africa
submarines
women of world war ii
24th division
cavalry
chindits
eagle squadrons
fleet air arm
guards brigade
imperial camel corps
machine gun corps
rifle brigade
royal air force
raf bomber command
royal artillery
royal fusiliers
royal naval division
royal tank regiment
london troops
arkley
bromley
chingford
chipping barnet
cockfosters
croydon
east barnet
enfield town
finchley
friern barnet parish
fulham
golders green
hampstead
hampton wick
hendon
hornsey
islington
kingston
monken hadley
new barnet
new malden
paddington
rainham
richmond
st michael cornhill parish
st saviour southwark parish
silvertown
streatham
twickenham
wood green
baltic exchange
bank of england
british medical association
great eastern railway
great western railway
lincolns inn
london and north western railway
london brighton and south coast railway
pearl assurance
south suburban gas company
victoria tower gardens
hyde park
kindertransport
victims of communism
korean war
iraq and afghanistan
blue plaques
kensington and chelsea
city of westminster
atalanta
the barbican muse
bellerophon taming pegasus
the bermondsey lion
big 4
bull
the burghers of calais
christ child
cornerstone
crystal palace dinosaurs
the diver
dolphin lamp standards
dragon boundary marks
elfin oak
enwrought light
father time
fulcrum
the gold smelters
gorilla
the hampstead figure
homage to leonardo
icarus
labyrinth
liberty clock
london noses
london pride
the meeting place
the messenger
millennium dial
monolith and shadow
the naked ladies
the neighbours
nelsons ship in a bottle
nike
paternoster vents
peckham arch
physical energy
platforms piece
popes urn
putney sculpture trail
the queens beasts
the rush of green
st pauls cross
slipstream
south bank lion
still water
tortoises with triangle and time
traffic light tree
union horse with two discs
the watchers
the world turned upside down
the young lovers
fourth plinth trafalgar square
the end
hahncock
one other
blind beggar and his dog
horse and rider
paternoster
meridian
single form memorial
two forms divided circle
winged figure
the arch 19791980
draped seated woman 195758
knife edge two piece 196265
locking piece
three standing figures 1947
the artist as hephaestus
piscator
the line
arcelormittal orbit
here
quantum cloud
liberty grip
a slice of reality
buxton memorial
diana princess of wales memorial fountain
diana fountain bushy park
diana fountain green park
edward vii jewish memorial fountain
henry fawcett memorial
the horses of helios
guilford place
matilda fountain
readymoney drinking fountain
revolving torsion
roehampton
st lawrence jewry and st mary magdalene
shaftesbury memorial
lady henry somerset memorial
victoria park
brixton
children at play
cable street
dulwich
old kent road
national covid memorial wall
poplar rates rebellion
poured lines
sutton twin towns
sutton heritage mosaic
from this moment despair ends and tactics begin
girl with balloon
one nation under cctv
pulp fiction
slave labour
northala fields
art on the underground
tube map covers
commission for diversity in the public realm
london mural preservation society
metropolitan drinking fountain and cattle trough association
city of london
barking and dagenham
hammersmith and fulham
kensington and chelsea
waltham forest
city of westminster
belgravia
covent garden
green park
hyde park
kensington
kensington gardens
knightsbridge
mayfair
millbank
paddington
pimlico
st jamess
st marylebone
trafalgar square
victoria embankment
westminster
whitehall
list of public art formerly in london
|
Links to external pages
Outloing links
www.wikidata.org
commons.wikimedia.org
geohack.toolforge.org
commons.wikimedia.org
www.lutyenstrustexhibitions1.org.uk
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 83 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 46 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 588 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 8 folders above or in the first level of navigation. | |
Headings | 76% | Headers should reflect the contents of a site. This site has a 33 % match | |
Links | 8% | Link anchors should to some degree reflect the contents of a site. This site has a 4 % match | |
Image alt tags | 0% | Image alt tags should to some degree reflect the contents of a site. This site has a 0 % match | |
Bold and italic | 27% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 9 % match | |
Html ratio | 60% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 38% | 38.461538461538 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 3693 words | |
Server response time | 30% | A slow server slows down a website. This server responds 21.69% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 30% | There are no important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 186 inline style declarations ( <a style="color:green">) with a size of 3719 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
13 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/e/e7/cscr-featured.svg/20px-cscr-featured.svg.png height: 19 width: 20 description: featured article |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/7/7d/civil_service_rifles_memorial%2c_front_%283%2c_cropped%29.jpg/220px-civil_service_rifles_memorial%2c_front_%283%2c_cropped%29.jpg height: 414 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/f/f2/inspection_of_the_civil_service_volunteers_at_somerset_house_by_the_prince_of_wales.jpg/220px-inspection_of_the_civil_service_volunteers_at_somerset_house_by_the_prince_of_wales.jpg height: 151 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/6/64/civil_service_rifles_memorial%2c_somerset_house_%289%29.jpg/220px-civil_service_rifles_memorial%2c_somerset_house_%289%29.jpg height: 164 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/a/a1/civil_service_rifles_memorial_-_view_from_northeast_01.jpg/220px-civil_service_rifles_memorial_-_view_from_northeast_01.jpg height: 293 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/4a/commons-logo.svg/30px-commons-logo.svg.png height: 40 width: 30 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/4a/commons-logo.svg/12px-commons-logo.svg.png height: 16 width: 12 description: no alt description found |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.png height: 31 width: 88 description: wikimedia foundation |
|
http://en.wikipedia.org/static/images/footer/poweredby_mediawiki_88x31.png height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!