www.slideshare.net website review
Improve your SEO :: free trial!
www.slideshare.net is 65% geoptimaliseerd!
SEO Keyword summary for www.slideshare.net/slideshow/food-safety_challenges-food-safety-laboratories_-pdf/267845129
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be food
Focus keyword
Short and long tail
Short Tail Keywords food safety pesticide |
long Tail Keywords (2 words) food safety testing laboratories food testing safety challenges challenges facing |
long Tail Keywords (3 words) safety challenges facing food testing laboratories food safety challenges facing the food chemical food contaminates different chemical food haccp and iso-22000 |
www.slideshare.net On-Page SEO Scan
Descriptive Elements
The <head> element of a www.slideshare.net/slideshow/food-safety_challenges-food-safety-laboratories_-pdf/267845129 page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
food safetychallenges safety laboratoriespdf
Meta description
Meta description legth
Meta description SEO
food safetychallenges safety laboratoriespdf download pdf view online free
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Nu emphasized (bold or italic) words detected !
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
slideshare scribd company logo sherif taha assoc professor mohamed tahascientific consultant gltlab director first qcap branch ismalia egypt central laboratory residue analysis pesticides heavy metals foodsherif tahagmailcom sheriftahaglobalomancom sheriftahaqcapegyptcomfood safetychallenges facing food testing laboratories photo httpswwwistockphotocomphotocuteasianlittlechildgirleatingwatermelonfreshfruitinthegardengm safety challenges introduction chemicalsafetybiologicalsafetyfood qualityandimprovementsfood fraudfood protection theconsumer without any negative impact onthe healthfood secure tradefood chemical contamination results fromusing chemicals during production thefood being contact toxic chemicalschemicalfood safetypesticidesveterinarydrugsdioxinheavymetalsmycotoxinspreservativesthere are also naturallyoccurring toxinswhich compounds producedby living organisms like alkaloids cigoatoxinseg shellfish potatoes fishhttpscdnprodmedicalnewstodaycomcontentimagesarticles amansprayingpesticidesintoafieldofcropsthatwillbeusedforfoodjpghttpswwwefsaeuropaeuennewsveterinarydrugresiduesfoodcompliancerateshighestdecadefood variouschemicals biological refers contaminationfood such humansrodents pests microorganismsincluding bacterial viral yeast moulds andparasites contaminationbiologicalhazardsnorovirussalmonellaecoliclostridiumbotulinumbiological contaminated may occur throughsaliva pest drops fecal matterhttpsencryptedtbn gstaticcomimagesqtbnand gctmwqpy dgtgyuxh oxcqrdjjmurayrhab ngusqpcaufood bio hazards improvements additivesincluding additives foodenzymes flavoringsfood qualityandimprovementssodiumcarbonatecolorspreservativesnitrate andnitritesfumaric acidpropyleneglycolhttpschefsforseniorscomblog foodadditivesandpreservativestoavoidhttpswwwunlockfoodcaenarticlesfoodtechnologythetruthaboutnitratesinfoodaspxhttpsatlantablackstarcom topfoodadditivesavoidsummerfood quality fraudoilscheesemilkinactiveproductsyeastmeathoneyhttpswwwfoodnavigatorcomarticle beeffraudcounterfeitproductsthebiggestthreattosupplychainhttpswwwepicuriouscomingredientssevenwaystotellthedifferencebetweenrealandfakeoliveoilarticlehttpswwwfoodbeastcomnewsgoattheotherwhitemilkhttpswwwhealthharvardedublogdairyhealthfoodorhealthrisk fraud referred httpswwwhealthlinecomnutritionpaprikabenefitslead arseniccadmiumethylene oxideaflatoxinspesticidesochratoxin aunauthorized colorsalmonellaherbal spices plantsfood samesample httpscfishctcombloghowtocooktunalisteria salmonellaarsenicmercuryveterinary drugshormonesdioxins andpobs fishbenzoa pyrene polycyclic aromatic hydrocarbons pahshistaminefood samesamplechlorinated propanols mcpd proper regulationsmain factors mainly affects how solve itclear guidanceefficient laboratoriesmonitoring programsgathering efforts between different authorities adjacent countriesfood shortageincreased cost testingenvironmental contaminationclimate changesfood mainaffects onfood httpswwwmonitorcougugandanewsnationalrubirizineedsshs btogetsafewaterforthousands temperature especially humidity increase fungal growth damaging cropseg mycotoxins storage transportation largely affected climatechanges microbial pathogens water scarifying leads occurrence microbialcontaminated increased algae oneconcentrated climate changes presence new plantpests risks from already known whichmay risk uncontrolled practicesfood amount per hectareof agricultural lands countriesaccording its national incomethe developed countries not suffer consequences ofpesticide applications developing sufferhttpsdoiorg jfoodpol techniquesto wide contaminatesinstrument maintenanceenough spare partschecking performancetrained stafflcmsms gcmsmsmycotoxinsantibioticshighly polar polarpesticideshighly nonpolar polarpesticidespersistence organicpollutantsmelamine cyanuricmaintechniquesfood laboratorieslow mwt thermal stablecompoundspoly foodcontaminatesinstrument staffmaintechniquesmaintechniquesfood stafficpmsicpoesicpmsmsmaintechniquesfood laboratoriesheavy maypresent industrial packaging environmentalcontamination staffgcmshrgcmshrmaintechniquesfood maintenancenon target analysisadvancedtechniquesspecific technical experiencesmaintechniquesfood maintenancepesticide residuesheavy metalspopsmycotoxinsveterinary drugsfood qualityfood contactmaterialsmaintechniquesfood covering widedifferent contaminatesdealing huge number samplesstorageprocessingpreparationanalysissampleprocessingfood laboratoriescryogenicmilling contaminatessamplepreparationfood laboratorieshttpswwwgerhardtdeenanalysismethodschemicalextractionhttpswwwhielschercomsoxhletextractionsetupandfunctionhtm samplestoragefood laboratorieshttpswwwmynewlabcombloghowtodesignbuildandmaintainacoldroomhttpsstockareaioblogsadvantagesofcoldstoragehttpswwwbuerkledeensamplecontainerpuredealing samples there more than pesticidesstandardsstock andwork solutionsfood laboratoriesthere veterinary drugsmsdsshelf lifepuritycertiflims once receipt equiliprate reference standard room temp stock working solutionsstandardsstock laboratoriesequipment balance accuracy volumetric flasks pipette class amatrix matched calibration versus pure solventpreventing cross separate tools waste disposalsolvent analyte solubility stabilityweighing out weight inside hood transfer flask using glassboat make volume sonicate store chemicalsand sparestorefood environmenthealthsafetyfood laboratoriesrisk managementpersonnel protective environmentsafe disposalus occupational health administration oshachemical fire ucla university ofcalifornia los angeles sheri singi tertbutyllithiumpoisoning dartmouthusa heavymetal prof karin dimethyl mercury continual improving all thelaboratory staffnational internationalcooperationbeing toagricultural area andportslowering detection limitscontinual methoddevelopmentsqcstaffregulationsloqfood laboratoriesall customers needs certificatesas soon possible accreditationquality measurementsqualitymanagementfood laboratoriesvalidationdocumentationmetrological traceabilityinternal external qcmeasurement uncertaintymanagement review customer feed backisoiec santequality manual sop sampletraceability instrumental maintenancestaff trainingorganizationinternal technicalresponsible externalinter relationsand legal agreements pesticide management eutake decisionsapproval active substances setting maximum residuelevels mrls after asking efsa andenvironmental these substancesaskreview report pesticideresidues suggest proposal mrlsefsa panelplant products residuesprovide guidance documents riskassessment theoperators consumersreportadvice unthe framework managementfao who responsible pesticidemanagement life cycle unjmpmfaowho joint meeting pesticidemanagementsupport fao managementguidance theagriculture public healthjmprfaowho residueprovide codex alimentarius commission cac thepesticide acceptable limits reviewingtoxicological residual field trialsjmpsfaowho specificationssupport specifications anyextension modification withdrawal unjmpmuneporganisation economic cooperationand developmentinternational biocontrolmanufacturers associationjmpm under uninternational agreementsrotterdam conventionan international agreement thetrade hazardous withhealth environmental protectionbasel conventioncontrolling internationalmovements stockholm conventionprotecting andenvironment pops egyptnfsa authorityintroduce implement regulations ensure safetypesticide egyptsetting foodresponsible export import foodthe registration ofpesticides productionapc agriculture committee perform survey studies local markets based onnational programs committeepesticide worker training committeebioassay committeeadvisory committeefood several guidelines apc online available arabicfood issuing labels productspesticide effect plantweed research wrcl plant pathology instituteplant institute ppricentral caplcentral lab qcapfood thank youassoc tahasherif hygiene issues primary foy pptpdf mba final presentation global intestinal disorders status poultry flockshafez muenc victory theme sanitation abu dhabi control authority gmo issue regulation hygine practicepdf module ppt session four autosavedpptx fsma friday january preparing within trends microbiological assessment industry role microbiology ijfsv insidious categories haccp iso assurance aquaculture security full pacific agribusiness forum api cegumalua importance stan introductionppt francisco diezgonzalez potential consumer qual gmp virus vaccine ignou modifiedm common multi extraction methodsrenamed pdf classification foodrenamed mass spectrometry ion motion commonly used analyzerpdf ionizations techniques spectrometrypdf hplca practical guide beginner userspdf gas chromatography introductionpdf unit aptitude ugc net paper ipdf introductionbiopesticides icmpptx accursed house mile gaboriaupptx azure interview questions answers scholarhat protectable subject matters biotechnology othe executive directors chat leveraging diversity equity inclusion chapter islamic banking servicespptx strand hygienic practicespptx grade cbc media resource materialpdf cacjapan group francesca gottschalk can education support child empowermentpptx ting anh success file nghe maximizing llm performancepptx operation blue star saka neela tara normal labour stages mechanism supporting ukri monographs salfordpptx modern centered mahatma gandhi pptx tesda reviewer written oral model attribute check auto property special bed year old
Mobile SEO www.slideshare.net/slideshow/food-safety_challenges-food-safety-laboratories_-pdf/267845129
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for www.slideshare.net/slideshow/food-safety_challenges-food-safety-laboratories_-pdf/267845129
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
18 characters long
Domain name SEO Impact
Path name
challenges found in path !
food found in path !
how found in path !
laboratories found in path !
pdf found in path !
safety found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
HTML request without WWW redirected correctly?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
VLAKWA presentation abu dhabi food control authority
|
amanramdzan food safety and quality assurance
|
category education
|
rss 1
|
slideshow food hygiene issues in primary production
foy580 pptpdf
mba 646 final presentation
global food safety2013
impact of intestinal disorders on health status in poultry flockshafez muenc
victory
who theme 2015 food safety
food safety and sanitation
gmo issue and regulation
food hygine practicepdf
module 02 introduction to food safety 3318ppt
session four food hygiene and safety autosavedpptx
fsma friday january 2023 preparing for safety risks within global food trends
microbiological assessment in food industry
role of microbiology in food safety
ijfsv10 8
the insidious food hazards as new categories in haccp and iso22000 based sy
aquaculture 2 food safety hazards 2013
food safety security full final
2nd pacific agribusiness forum api cegumalua importance of food safety stan
module 0 introductionppt
dr francisco diezgonzalez the potential impact of consumer trends on qual
virus safety in vaccine production
ignou181009 modifiedm
ignou181009 modifiedm
common multi pesticide residue extraction methodsrenamed0001pdf
pesticides classification and maximum residue limits in foodrenamed0001pdf
mass spectrometry ion motion in the commonly used mass analyzerpdf
commonly used ionizations techniques in mass spectrometrypdf
hplca practical guide for the beginner userspdf
gas chromatography an introductionpdf
unit 2 research aptitude ugc net paper ipdf
s1introductionbiopesticides in icmpptx
the accursed house by mile gaboriaupptx
azure interview questions and answers pdf by scholarhat
protectable subject matters protection in biotechnology protection of othe
executive directors chat leveraging ai for diversity equity and inclusion
chapter 3 islamic banking products and servicespptx
strand 3 hygienic practicespptx grade 7 cbc
mass media studies835class xi resource materialpdf
cacjapan group presentation 1 wk 4pdf
francesca gottschalk how can education support child empowermentpptx
bi tp b tr ting anh global success lp 3 c nm c file nghe v p
a survey of techniques for maximizing llm performancepptx
operation blue star saka neela tara
normal labour stages of labour mechanism of labour
supporting ukri oa monographs at salfordpptx
14 modern child centered education mahatma gandhi2pptx
tesda tm1 reviewer for national assessment written and oral questions with a
model attribute check company auto property
special bed 2nd year old paper20240531pdf
56202447thank youassoc professor
|
www.slideshare.net sherif taha
ssuser12fa71
yahya a a abdulqader
asian food regulation information service
dsm animal nutrition health
kaustuv bose
rashmi kumar
jemimah gumalal
vlaams kenniscentrum water vlakwa
vivek yadav
nuhamintesfaye
rapidacademy
datum2
safetychain software
abdul rehman
samra rana
guestb31f27
sekheta bros company
universiti malaysia sabah
yasir rehman
brussels briefings brusselsbriefingsnet
maumitaghosh5
john blue
aloisaga01
dr priyabrata pattnaik
rakesh khandal
sherif taha
thiyagu k
tarandeep35
dhatriparmar
scholarhat
sachin r kondaguri
techsoup
mohd adib abd muin senior lecturer at universiti utara malaysia
kimdan468
goswamiyash170123
camakaiclarkmusic
eduskills oecd
nguyen thanh tu collection
thanhdowork
balvir singh
wasim ak
josvitadsouza2
eugenesaldivar
celine george
special education needs
about
copyright
|
Links to external pages
Outloing links
support.scribd.com
support.scribd.com
support.scribd.com
www.twitter.com
SEO Advice for www.slideshare.net
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 65% | A title should reflect the contents of a site. This site has a 50 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 53 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 60% | The meta description should be between 145 and 160 characters. This meta description is 97 characters long. | |
Meta description relevance | 59% | Meta Description should reflect the contents of a site. This site has a 33 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 267 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 5 level 1 folders and 59 folders above or in the first level of navigation. | |
Headings | 67% | Headers should reflect the contents of a site. This site has a 28 % match | |
Links | 18% | Link anchors should to some degree reflect the contents of a site. This site has a 9 % match | |
Image alt tags | 14% | Image alt tags should to some degree reflect the contents of a site. This site has a 5 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 100% | All images on this page have been described. Great job ! | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 5807 words | |
Server response time | 30% | A slow server slows down a website. This server responds 479.92% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 401 inline style declarations ( <a style="color:green">) with a size of 9180 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 1 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 100% | Perfect, we did not detect too many CSS files | |
Javascript | 30% | Wij detected too much (14) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 100% | Perfect, we found a correct use of normalized headings ! |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.slideshare.net images and descriptions
4 images found at www.slideshare.net Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://public.slidesharecdn.com/images/next/logo-slideshare-scribd-company.svg?w=256&q=75 height: 30 width: 120 description: slideshare a scribd company logo |
|
https://cdn.slidesharecdn.com/profile-photo-sheriftaha-48x48.jpg?cb=1715012410 height: height attribute not set width: width attribute not set description: sherif taha |
|
https://image.slidesharecdn.com/foodsafetychallengesfoodsafetylaboratories-240506162253-ac13a230/85/food-safety_challenges-food-safety-laboratories_-pdf-1-320.jpg height: height attribute not set width: width attribute not set description: 5/6/2024 1 assoc. professor/ sherif mohamed taha scientific consultant glt lab director of the first qcap branch at ismalia (egypt), central laboratory of residue analysis of pesticides and heavy metals in food [email protected] , [email protected], [email protected] food safety; challenges facing the food testing laboratories |
|
http://www.slideshare.net/data:image/gif;base64,r0lgodlhaqabaiaaaaaaap///yh5baeaaaaalaaaaaabaaeaaaibraa7 height: height attribute not set width: width attribute not set description: special b.ed 2nd year old paper_20240531.pdf |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!